Protein coding transcript 101452

• Transcript: Ll_transcript_460121
• CDS coordinates: 961-1680 (+)
• Peptide sequence: MHYIYITSRGLLHTCICRYFNIHYSLCFYLFLIMPLFVFPIFILFKWDVFVYRYELGRQPANTKLSSNKTVRRIRVRGGNVKWRALRLDTGNFSWGSEAVTRKTRLLDVVYNASNNELVRTQTLVKSAIVQVDAAPFKQWYLQHYGIEIGRKKKSTTSAKKEGEVAETATEEAKKSNHVLRKLEKRTQNRVLDPHIEEQFGGGRLLASISSRPGQCGRADGYVTLCSSMVFCSQWGSIF*
• ORF Type: complete

Annotations of Ll_transcript_460121

• Blastp: 40S ribosomal protein S8 from Zea with 81.32% of identity
• Blastx: 40S ribosomal protein S8 from Zea with 80.11% of identity
• Eggnog: 40S ribosomal protein S8(COG2007)
• Kegg: Link to kegg annotations (103654822)
• CantataDB: Link to cantataDB annotations (CNT0001468)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016182244.1)
• Pfam: Ribosomal protein S8e (PF01201.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;