Protein coding transcript 106778

• Transcript: Ll_transcript_299481
• CDS coordinates: 585-1493 (+)
• Peptide sequence: MLADQMMNRIEYVHSKGFLHRDIKPDNFLMGLGRKANLVYIIDFGLAKRYRDSTTNRHIPYRENKNLTGTARYASCNTHLGIEQSRRDDLESLGYVLLYFLRGSLPWQGLKAATKKQKYDKICEKKVSTPIEALCKSHPVEFTSYFHYCHSLTFDQRPDYGFLKRLFRELFTREGYEFDYVFDWTILKYQQSQKNRVQPRISPVPGASNSRAMPMVLDNHQGDVSERIKSGNATSSGVKIQFKSPLAKNLGSENPLGKNIFGEADVPSTSFSLAGTSRRNPLKPALSTEASNHVHGQGSPFK*
• ORF Type: complete

Annotations of Ll_transcript_299481

• Blastp: Casein kinase 1-like protein 3 from Arabidopsis with 70.03% of identity
• Blastx: Casein kinase 1-like protein 3 from Arabidopsis with 72.99% of identity
• Eggnog: Casein Kinase(ENOG410XPGP)
• Kegg: Link to kegg annotations (AT4G28880)
• CantataDB: Link to cantataDB annotations (CNT0000756)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419529.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;