Protein coding transcript 111088

• Transcript: Ll_transcript_295128
• CDS coordinates: 1-306 (+)
• Peptide sequence: ENYGKQGLLCGSDGLPHLIVSGDQRHWGEFITPGVLFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASRLLFKGFSWPIAAYRELLNGERVAKDV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_295128

• Blastp: Photosystem I reaction center subunit III, chloroplastic from Flaveria with 88.12% of identity
• Blastx: Photosystem I reaction center subunit III, chloroplastic from Flaveria with 88.12% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419655.1)
• Pfam: Photosystem I reaction centre subunit III (PF02507.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;