Transcript | Ll_transcript_295128 |
---|---|
CDS coordinates | 1-306 (+) |
Peptide sequence | ENYGKQGLLCGSDGLPHLIVSGDQRHWGEFITPGVLFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASRLLFKGFSWPIAAYRELLNGERVAKDV* |
ORF Type | 5prime_partial |
Blastp | Photosystem I reaction center subunit III, chloroplastic from Flaveria with 88.12% of identity |
---|---|
Blastx | Photosystem I reaction center subunit III, chloroplastic from Flaveria with 88.12% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419655.1) |
Pfam | Photosystem I reaction centre subunit III (PF02507.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer