Transcript | Ll_transcript_445800 |
---|---|
CDS coordinates | 265-582 (+) |
Peptide sequence | MREILHIQGGQCGNQIGAKFWEVICDEHGIDHTGKYSGDSELQLERINVYYNEASGGRYVPRAVLMDLEPGTMDSLRSGPFGQIFRPDNFVFGQSGAGHNWAKGHY |
ORF Type | 3prime_partial |
Blastp | Tubulin beta chain from Soja with 97.17% of identity |
---|---|
Blastx | Tubulin beta chain from Soja with 97.17% of identity |
Eggnog | protein polymerization(COG5023) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419481.1) |
Pfam | Tubulin/FtsZ family, GTPase domain (PF00091.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer