Protein coding transcript 113616

• Transcript: Ll_transcript_397752
• CDS coordinates: 573-872 (+)
• Peptide sequence: MRLMEGEHVGPFNLGNPGEFTMLELAKVVQETIDPDAKIEYRDNTEDDPHKRKPDISKAKEQLGWEPKVDLRKGLPLMVSDFRQRIFGDHKEGAAATFA*
• ORF Type: complete

Annotations of Ll_transcript_397752

• Blastp: UDP-glucuronic acid decarboxylase 2 from Arabidopsis with 88.17% of identity
• Blastx: UDP-glucuronic acid decarboxylase 2 from Arabidopsis with 86.27% of identity
• Eggnog: Nad-dependent epimerase dehydratase(COG0451)
• Kegg: Link to kegg annotations (AT3G62830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427927.1)
• Pfam: GDP-mannose 4,6 dehydratase (PF16363.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;