Protein coding transcript 114878

• Transcript: Ll_transcript_471833
• CDS coordinates: 213-761 (+)
• Peptide sequence: MDRCFRFFPCLVDPGRRSSLWLKLAFVTIHVVYIAILFLFDGDLVEKTRKEPWYTALYLLLCAVTLIQYFATSIASPGYALNAMRAVNERNAVYRQTSETSNQSASSRNGSFIVTVEGNLIGRNVSGSNASDWSKLVADLYSASPIRTWTCTYCNVEQPPRTKHCHDCDKCVLQFDHHCVWLG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_471833

• Blastp: Protein S-acyltransferase 10 from Arabidopsis with 56.83% of identity
• Blastx: Protein S-acyltransferase 10 from Arabidopsis with 55.61% of identity
• Eggnog: Zinc finger, DHHC-type containing(COG5273)
• Kegg: Link to kegg annotations (AT3G51390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421300.1)
• Pfam: DHHC palmitoyltransferase (PF01529.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;