Protein coding transcript 115256

• Transcript: Ll_transcript_472748
• CDS coordinates: 207-920 (+)
• Peptide sequence: MSQPKIKRRVGKYEVGRTIGEGTFAKVKFARNPETGEPVALKILDKEKVLKHKMAEQIRREIATMKLIKHPNVVRLFEVMGSKTKIFIVLEFVTGGELFDKIVNHGRMSENEARRYFQQLINAVDYCHSRGVYHRDLKPENLLLDTYGNLKVSDFGLSALSQQVRDDGLLHTTCGTPNYVAPEVLNDRGYDGANADLWSCGVILFVLVAGYLPFDGPNLIDLYKKISAAEFTCPPWLS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_472748

• Blastp: CBL-interacting serine/threonine-protein kinase 3 from Arabidopsis with 88.46% of identity
• Blastx: CBL-interacting serine/threonine-protein kinase 3 from Arabidopsis with 88.46% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G26980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460783.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;