Protein coding transcript 116482

• Transcript: Ll_transcript_472949
• CDS coordinates: 197-574 (+)
• Peptide sequence: MVGPTRPQFVLFGSSIVQMSFSHGGWGSILSDIYARKADVLLRGYYGWNSRRALQILNEVFPKGSAAQPSLVIVYFGGNDSMGSHSSGLGPHVPLPEYIENMQKILVHLKVLLLCLIFNHQVLSP*
• ORF Type: complete

Annotations of Ll_transcript_472949

• Blastp: GDSL esterase/lipase CPRD49 from Arabidopsis with 75.89% of identity
• Blastx: GDSL esterase/lipase CPRD49 from Arabidopsis with 77.67% of identity
• Eggnog: lipolytic protein G-D-S-L family(COG2755)
• Kegg: Link to kegg annotations (AT3G11210)
• CantataDB: Link to cantataDB annotations (CNT0002915)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414304.1)
• Pfam: GDSL-like Lipase/Acylhydrolase (PF00657.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;