Protein coding transcript 118415

• Transcript: Ll_transcript_304693
• CDS coordinates: 389-1102 (+)
• Peptide sequence: MVKALARVVSNVQVQESSEESLAAVAGMFSSKAKGIEWSLDNDASNAAVLVASEAHAITLAVEGLLGAVFTVATLTDEAIDVGELESPRGDNDPPLKWTGKTAVLCISMVDSLWLTILDALSLILSRSQGEAIVLEILKGYQAFTQACGILRAVEPLNSFLASLCKFTINFPVETEKRSALPSPVSKRTELSVDQRDSVVLTPKNVQALRTLFNIAHRLHNVLGPSWVLVLETLAALA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_304693

• Blastp: Protein MON2 homolog from Sophophora with 26.56% of identity
• Blastx: Protein MON2 homolog from Sophophora with 26.56% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (Dpse_GA16450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439975.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;