Protein coding transcript 118832

• Transcript: Ll_transcript_306780
• CDS coordinates: 653-1606 (+)
• Peptide sequence: MRVFNVYIQEEKVLSELDIFAVVGANKPLQLIDSRVRVKDDGVILIRFESINGSPLVSGIGIRKATNVSVPQVTSDYIKCNYCAMEIEIPSPQKKVMWTKSTAKYENKIKELTMQCDLKAKECYEAWISLTATNEQLEATQMELDKVTFKSLSIDQTLEKQAENLRSISSRYDLDKKKWAEEIVSLQEKVKLMKSDYCQLSFEAHECVDSIPELNKMVFAVQELVKQCEDLKVKYNEEMTQRKKLFNEVQEAKGNIRVFCRCRPLNKVEISAGCSTVVDFDAAKDGCLGILSNGSTKKSFRFDRVYTPKDDQVDVFL*
• ORF Type: complete

Annotations of Ll_transcript_306780

• Blastp: Kinesin-like protein KIN-14R from Arabidopsis with 59.18% of identity
• Blastx: Kinesin-like protein KIN-14R from Arabidopsis with 57.4% of identity
• Eggnog: Kinesin family member(COG5059)
• Kegg: Link to kegg annotations (AT2G22610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422126.1)
• Pfam: Di-glucose binding within endoplasmic reticulum (PF11721.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;