Protein coding transcript 118844

• Transcript: Ll_transcript_306797
• CDS coordinates: 390-707 (+)
• Peptide sequence: MSLTTTNEQLEATQMELDKVTFKSLTIDQTLEKQAEDLRSISSRYELDKKKWAEAIRSLQEKVKLMKSDYCQLSLEAHECVDSIPELNKMVFFFFLLVSSVKISK*
• ORF Type: complete

Annotations of Ll_transcript_306797

• Blastp: Kinesin-like protein KIN-14R from Arabidopsis with 54.55% of identity
• Blastx: Kinesin-like protein KIN-14R from Arabidopsis with 51.5% of identity
• Eggnog: Kinesin family member(COG5059)
• Kegg: Link to kegg annotations (AT2G22610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445359.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;