Protein coding transcript 120454

• Transcript: Ll_transcript_486140
• CDS coordinates: 2-331 (+)
• Peptide sequence: KDKDDAIEMLGKKVDTLTKAMEVEAKKMRREVATMEKEVASMRVEKEQDSRSKRFSAVKTPINSAQHQLVSGRDAGTERNSRWDLGREHQLHALFAFQEMGFFKKLCFH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_486140

• Blastp: Microtubule-associated protein 70-2 from Arabidopsis with 76.32% of identity
• Blastx: Microtubule-associated protein 70-2 from Arabidopsis with 76.32% of identity
• Eggnog: Microtubule-associated protein(ENOG410ZDCM)
• Kegg: Link to kegg annotations (AT1G24764)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421578.1)
• Pfam: Microtubule-associated protein 70 (PF07058.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;