Protein coding transcript 121506

• Transcript: Ll_transcript_348783
• CDS coordinates: 1051-1689 (+)
• Peptide sequence: MNVLNPFVRQFLVGWITVLDSVPDIDMLGFLPDFLDGLFNMLSDSSHEIRQQADSALSEFLQEIKNSPSVDYGRMAEILVQRAGAPDEFTRLTAITWINEFVKLSGDQLVPYYAVILAAILPCISDKEEKIRVVARDTNEELLAIKADLAEAFDVEAVLSIARRCSFSDLGKVARQISSEWEATRIEALHWISTLLNRYRTEVTGLFEFRLL*
• ORF Type: complete

Annotations of Ll_transcript_348783

• Blastp: Protein VAC14 homolog from Arabidopsis with 82.27% of identity
• Blastx: Protein VAC14 homolog from Arabidopsis with 75.48% of identity
• Eggnog: vac14 homolog (S. cerevisiae)(ENOG410XP6E)
• Kegg: Link to kegg annotations (AT2G01690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432671.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;