Protein coding transcript 126886

• Transcript: Ll_transcript_480446
• CDS coordinates: 2-424 (+)
• Peptide sequence: FNSKNIMPSTTLFTFLLFLTFLHANAFVFEGFHNNSKLILSGASIIKTSALLRLTNTSTNIIGHAFYANPFKMFNTTNSSLQPNPNYSFSTSFVFSIVSPSSGSGGFGLAFTIAPSTEFQGAEAGNFLGLVNSSNNGNVSN
• ORF Type: internal

Annotations of Ll_transcript_480446

• Blastp: Lectin-domain containing receptor kinase VI.3 from Arabidopsis with 44.17% of identity
• Blastx: Lectin-domain containing receptor kinase VI.3 from Arabidopsis with 44.44% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G01550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429697.1)
• Pfam: Legume lectin domain (PF00139.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;