Protein coding transcript 130670

• Transcript: Ll_transcript_82804
• CDS coordinates: 127-663 (+)
• Peptide sequence: MGPLKAPGPDGLHPLFFQSQWQVVGPSVIKFVQQCFENPSLIHQTVTKVITNRLRDVMGELVSPNLCSFVPGRHGSDNVIIALEVFHSMHTLKRKTGWVAIKVDLEKSYDKLSWSFLQETLHRIEIKDHMCSLIMHCVTSCSYRVCFNGDRSPPVIPHRGLCQGNPLSPIYLFCAWKC*
• ORF Type: complete

Annotations of Ll_transcript_82804

• Blastp: LINE-1 retrotransposable element ORF2 protein from Mus with 25.25% of identity
• Blastx: Putative ribonuclease H protein At1g65750 from Arabidopsis with 26.57% of identity
• Eggnog: NA(ENOG41120A8)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020210568.1)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF00078.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;