Protein coding transcript 131103

• Transcript: Ll_transcript_175576
• CDS coordinates: 1-822 (+)
• Peptide sequence: RKPLFFGEGTILRQVDTNTGALRVGIHTGPFQREHVYSGGSCEVFTKFIGAKGKDVLYVGDHIFGDILKSKKIRGWRTFLIVPELVRELHVWTDKCQLFNELQTLDVKLGEMYKNLDSSTKEKPDISSIRAAIRDVTHKMDMSYGMMGSLFRSGSRQTFFSSQVVRYADLYAATHLNLLYYPFSYMFRAPAMLLPHESTVAHEQHFITEYQMEASDAEVSQSRRAPKILERTASQIPHVRPETPLQVTHNHDEDCSDEDSDDKIAAKNEEKSA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_175576

• Blastp: Cytosolic purine 5'-nucleotidase from Xenopus with 60.08% of identity
• Blastx: Cytosolic purine 5'-nucleotidase from Xenopus with 60.08% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (444729)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020984094.1)
• Pfam: 5' nucleotidase family (PF05761.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;