Transcript | Ll_transcript_169958 |
---|---|
CDS coordinates | 3-419 (+) |
Peptide sequence | LKEYGVSSNLIESLDLSNTGIQILHSSIKNLTRLHSLNLESLSLRNLPNELSYLRSLSDLKISNCALVLEKQMLHDIFQGLEHLKVLYLMDCPKMCELPNNISGLRELYELRLDGSNVESLPKSIKNLENLEILSLNN* |
ORF Type | 5prime_partial |
Blastp | Protein lap4 from Sophophora with 34.11% of identity |
---|---|
Blastx | - |
Eggnog | leucine Rich Repeat(COG4886) |
Kegg | Link to kegg annotations (Dmel_CG43398) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433713.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer