Protein coding transcript 131438

• Transcript: Ll_transcript_133526
• CDS coordinates: 1-372 (-)
• Peptide sequence: LHLQDNKLSGSLNKSVGNLSNLVELDISNNEFSGTLPDIFGSLSRLKVFSGDSNGFSGQLPTTLVNSQSIETLILDNNSFSGAINLNCSAMKNLTILGLGTNQFHGPIPGNLSDCLGLESINLA
• ORF Type: internal

Annotations of Ll_transcript_133526

• Blastp: Phytosulfokine receptor 1 from Daucus sect. Daucus with 55.65% of identity
• Blastx: Phytosulfokine receptor 1 from Daucus sect. Daucus with 55.65% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458999.1)
• Pfam: Leucine Rich repeat (PF13516.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;