Protein coding transcript 131837

• Transcript: Ll_transcript_133534
• CDS coordinates: 23-742 (-)
• Peptide sequence: MAERLAIGESWDRRLKRKIDEPSITNKDSNLLLSLSLSGSNTLQESSSNMMPHADSNFDPKLVENSNNKGVIKPKEHEFSCKFCNKKFLNFQALGGHQNAHRRERILSKMNKEIAMGTFGFSAYPCPCSSMENIHPFHGSSCYHAAHMNPMAQMSPMPWHHSGHGYGNQGLHNTPFSGHQFGITSNLSTSVQTPQNLNQSDVGFGCEPYQASSLKDVVNKSTTTQNDLEGHPKNHYTRN*
• ORF Type: complete

Annotations of Ll_transcript_133534

• Blastp: Zinc finger protein 3 from Arabidopsis with 40.28% of identity
• Blastx: Zinc finger protein 3 from Arabidopsis with 40.28% of identity
• Eggnog: zinc finger protein(ENOG410YPEB)
• Kegg: Link to kegg annotations (AT5G25160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420668.1)
• Pfam: C2H2-type zinc finger (PF13912.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;