Protein coding transcript 132325

• Transcript: Ll_transcript_69950
• CDS coordinates: 570-1793 (+)
• Peptide sequence: MTKGAKFAQNHATTHCKYLVWTPSNGLGNRMLTLVAAFLYAILTDRVLLVKFGDDMLGLFCEPFPRSSWLLPMDFPYWKDRKHIQTYQNMLIKHRGNNSKELLPSFLILNLQHTHDGRNNFFHCDHSQELLHKVPVLILSSDQYFVPSLFMIPSFREDLSKMFPEKDTVFHHMGRYLFHPSNEAWELITKFHQAHFAKANERIGVQIRVFNTHKAPHQTIINEIIACTVKHKLLPELDLQKPAEAASVLKNQTTKAVLVASLFSEYGEKLRALYLRNTTVTNEVIRVYQPSHEERQKSSNGMHNIKAWTEIYLLSLCDSLITSRKSTFGYVAQSLGGLKPLILQRAFGETIPNPPCQRARSMEPCFHYPPKYDCSRSNTPVDFTSLFHYMMHCEDVSSGLRMVNVKH*
• ORF Type: complete

Annotations of Ll_transcript_69950

• Blastp: Galactoside 2-alpha-L-fucosyltransferase from Pisum with 49% of identity
• Blastx: Galactoside 2-alpha-L-fucosyltransferase from Pisum with 48.67% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000831)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447633.1)
• Pfam: Xyloglucan fucosyltransferase (PF03254.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;