Protein coding transcript 133322

• Transcript: Ll_transcript_117840
• CDS coordinates: 68-508 (+)
• Peptide sequence: MSSNSKVFTLDEVAKHNRKNDCWIIVSGKVYDVTPFLNDHPGGDLVILSATEKDATFEFEVVDHSESAIEDMQKYYVGEFETNTLPAEVDNTHNSPPPFRQADAPSTSNQSSGLVLKILKYLLPLLILASAYALQYYGKSSEPSES*
• ORF Type: complete

Annotations of Ll_transcript_117840

• Blastp: Cytochrome B5 isoform D from Arabidopsis with 49.31% of identity
• Blastx: Cytochrome b5 isoform E from Arabidopsis with 51.43% of identity
• Eggnog: cytochrome b5(COG5274)
• Kegg: Link to kegg annotations (AT5G48810)
• CantataDB: Link to cantataDB annotations (CNT0002027)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420584.1)
• Pfam: Cytochrome b5-like Heme/Steroid binding domain (PF00173.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;