Protein coding transcript 133343

• Transcript: Ll_transcript_117890
• CDS coordinates: 59-520 (+)
• Peptide sequence: MDELSKEQIALLKNAFDTFDVEKKGSIGTVMIGTILTMLGIHTTDTILADIIKEVDEDGSGELEFEEFIILASKFMIEEDAEAMQQELKEAFRLYDKEGNGYISTKTLKEILKELDDKLTNIELDGIVAEIDTDGSGTVDFDEFMEVMTGGDD*
• ORF Type: complete

Annotations of Ll_transcript_117890

• Blastp: Troponin C, isoform 1 from Sophophora with 73.03% of identity
• Blastx: Troponin C, isoform 1 from Sophophora with 73.03% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (Dmel_CG2981)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442849.1)
• Pfam: EF-hand domain pair (PF13833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;