Protein coding transcript 133458

• Transcript: Ll_transcript_175487
• CDS coordinates: 2-358 (+)
• Peptide sequence: SHSANPIDKEKIASLPTSTNFPSSILIHNEKDKLLDGLLVSGFDEASCTSRFQSHLFRKASPHKPSQYLISKLRQYEELHRKCGPNSRDFKRNMKFLHSKKKGAAGNCKYLVWTPANGL
• ORF Type: internal

Annotations of Ll_transcript_175487

• Blastp: Galactoside 2-alpha-L-fucosyltransferase from Arabidopsis with 53.54% of identity
• Blastx: Galactoside 2-alpha-L-fucosyltransferase from Arabidopsis with 53.54% of identity
• Eggnog: fucosyltransferase(ENOG410XXHE)
• Kegg: Link to kegg annotations (AT2G03220)
• CantataDB: Link to cantataDB annotations (CNT0000976)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414981.1)
• Pfam: Xyloglucan fucosyltransferase (PF03254.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;