Transcript | Ll_transcript_175487 |
---|---|
CDS coordinates | 2-358 (+) |
Peptide sequence | SHSANPIDKEKIASLPTSTNFPSSILIHNEKDKLLDGLLVSGFDEASCTSRFQSHLFRKASPHKPSQYLISKLRQYEELHRKCGPNSRDFKRNMKFLHSKKKGAAGNCKYLVWTPANGL |
ORF Type | internal |
Blastp | Galactoside 2-alpha-L-fucosyltransferase from Arabidopsis with 53.54% of identity |
---|---|
Blastx | Galactoside 2-alpha-L-fucosyltransferase from Arabidopsis with 53.54% of identity |
Eggnog | fucosyltransferase(ENOG410XXHE) |
Kegg | Link to kegg annotations (AT2G03220) |
CantataDB | Link to cantataDB annotations (CNT0000976) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414981.1) |
Pfam | Xyloglucan fucosyltransferase (PF03254.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer