Transcript | Ll_transcript_40480 |
---|---|
CDS coordinates | 95-709 (+) |
Peptide sequence | MMGRSMQYLALKTVPETVSFTDSHINELKLVAEKLFHDANKLGGLGFGTSSFKCVASFAAIYLLILDRTNWRTNMLTSLLVPYIFFSFPGFLFRCFRGEIGKWIASVAVVLRLFFPRHFPHWLEIPGSMILLLVVAPNLFAYKWRKNAIGIVIDLLIGCYLLQEHIRASGGFRNSFTQKHGISNTIGILFLLAYPVWALVLHFA* |
ORF Type | complete |
Blastp | Cold-regulated 413 plasma membrane protein 2 from Arabidopsis with 66.83% of identity |
---|---|
Blastx | Cold-regulated 413 plasma membrane protein 2 from Arabidopsis with 66.83% of identity |
Eggnog | Cold acclimation protein(ENOG4111SCF) |
Kegg | Link to kegg annotations (AT3G50830) |
CantataDB | Link to cantataDB annotations (CNT0000256) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420864.1) |
Pfam | Cold acclimation protein WCOR413 (PF05562.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer