Protein coding transcript 136960

• Transcript: Ll_transcript_95577
• CDS coordinates: 380-1522 (+)
• Peptide sequence: MTLLTLFVTATKLAGALVTLSVAANAFSFSRFRNKNLRTFRSPINDNDDTLADFNVTEVEDGFFFGLATAPAHVEDRLNDAWIQFAEEKTDNDSQEEEIKQPVDALIGSAAGDGGSQAATSSQHGAKQVKKGKKPLKVSMEAMIRGLEKFVDVEGQEAEEEPHYKVTAWHNVPHPEERLKFWSDPDTELKLAKDTGITVFRMGIDWSRIMPEEPINGLKESVNYAALERYKWIINRVRSYGMKVMLTLFHHSLPPWAGEYGGWKLEKTVDYFMDFTRLVVNGVIDLVDYWVTFNEPHVFCMLTYCAGTWPGGHPDMLEAATSALPTGVFQQTMHWISVAHSKAYDYIHEFRCVFLGEASEFVASLYYVYKSKTYILKLKF*
• ORF Type: complete

Annotations of Ll_transcript_95577

• Blastp: Beta-glucosidase-like SFR2, chloroplastic from Oryza sativa with 63.81% of identity
• Blastx: Galactolipid galactosyltransferase SFR2, chloroplastic from Arabidopsis with 58% of identity
• Eggnog: beta-glucosidase(COG2723)
• Kegg: Link to kegg annotations (4351127)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419477.1)
• Pfam: Cellulase (glycosyl hydrolase family 5) (PF00150.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;