Protein coding transcript 140979

• Transcript: Ll_transcript_108482
• CDS coordinates: 2-349 (+)
• Peptide sequence: ACQLSRYYDTYLPFLLEACNDEIPDVRQAAVYGLGVCAEFGGSVFKPLVGESLSRLNAVIQHPNALNGDNIMAYDNAVSALGKICQFHCDSIDSAQVFIVYDCFMVFTSQLCLAL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_108482

• Blastp: Importin-5 from Mus with 39.78% of identity
• Blastx: Importin-5 from Mus with 39.78% of identity
• Eggnog: Importin(ENOG410XQAJ)
• Kegg: Link to kegg annotations (70572)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431424.1)
• Pfam: HEAT repeat (PF02985.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;