Protein coding transcript 145218

• Transcript: Ll_transcript_25950
• CDS coordinates: 3-344 (+)
• Peptide sequence: QQGFLLFHSPSFFTCYCSSLSDKVTMYLQFYINDNGDKVYTTKKESPLGLATQSAHPGIFLITLILPFKLCYMCLLIIINLLLLGEITLTMLRFCLITFDTRILESYTHTNMG*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_25950

• Blastp: H/ACA ribonucleoprotein complex subunit 3-like protein from Arabidopsis with 80% of identity
• Blastx: H/ACA ribonucleoprotein complex subunit 3-like protein from Arabidopsis with 80% of identity
• Eggnog: rRNA processing(COG2260)
• Kegg: Link to kegg annotations (AT2G20490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462551.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;