Transcript | Ll_transcript_173486 |
---|---|
CDS coordinates | 162-512 (+) |
Peptide sequence | MNAPDRYERFVVPEGTKKVSYERDTKIINAASFTIEREDHTIANILRMQLHRDPNVLFAGYKLPHPLQYKIIIRIHTTSQSSPMQAYNQSINDLDRELDHLKNAFETEMMKFSRDY* |
ORF Type | complete |
Blastp | DNA-directed RNA polymerases II, IV and V subunit 11 from Arabidopsis with 83.62% of identity |
---|---|
Blastx | DNA-directed RNA polymerases II, IV and V subunit 11 from Arabidopsis with 83.62% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT3G52090) |
CantataDB | Link to cantataDB annotations (CNT0000035) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_014493325.1) |
Pfam | RNA polymerase Rpb3/Rpb11 dimerisation domain (PF13656.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer