Protein coding transcript 148651

• Transcript: Ll_transcript_173493
• CDS coordinates: 146-496 (+)
• Peptide sequence: MNAPDRYERFVVPEGTKKVSYERDTKIINAASFTIEREDHTIANILRMQLHRDPNVLFAGYKLPHPLQYKIIIRIHTTSQSSPMQAYNQSINDLDRELDHLKNAFETEMMKFSRDY*
• ORF Type: complete

Annotations of Ll_transcript_173493

• Blastp: DNA-directed RNA polymerases II, IV and V subunit 11 from Arabidopsis with 83.62% of identity
• Blastx: DNA-directed RNA polymerases II, IV and V subunit 11 from Arabidopsis with 83.62% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G52090)
• CantataDB: Link to cantataDB annotations (CNT0000035)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014493325.1)
• Pfam: RNA polymerase Rpb3/Rpb11 dimerisation domain (PF13656.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;