Transcript | Ll_transcript_29022 |
---|---|
CDS coordinates | 983-1819 (+) |
Peptide sequence | MGSFKGHALPGTLFFLVGVWHIWGAVVRYVCNPTTFRVQVWHPVPGFGGKLKHLELYVISIGSFIDLCIEFLYSTHLRFFVGGVLNPSHMNNFEHAGMLLMFFIFSVVVLLKEKTRFFPLPEGALCFIAATAFCAEYLLFYFHSTTHKGLEGYYHIILVFLIGLCILSSISGALMPTSFPVDLTNGIAIALQGIWFYQTAFVLYGPMLPNGCRVRDNMIACHSKESEVRGELLANFQLFIAVFVVLAGTTASYVFAASRYGNPEVNRLHTVQAELDQD* |
ORF Type | complete |
Blastp | Transmembrane protein 45B from Xenopus with 28.85% of identity |
---|---|
Blastx | Transmembrane protein 45B from Xenopus with 28.85% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (431891) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424418.1) |
Pfam | Family of unknown function (DUF716) (PF04819.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer