Protein coding transcript 15171

• Transcript: Ll_transcript_426320
• CDS coordinates: 122-568 (+)
• Peptide sequence: MKLTNLCMKNGAVFNYDSTHQVDQVDASSYKSCSASNSIKNYNDGNSKVPLTTSGTLYFICPTSGHCAGGMKLQVNVVAATSTTTPSGGSPPTTPSSGTTPTPSTPSQSGTPPATPSTKANGAISVSSGISHLIVSMFVAAIVFGFMG*
• ORF Type: complete

Annotations of Ll_transcript_426320

• Blastp: Uclacyanin-2 from Arabidopsis with 53.52% of identity
• Blastx: Uclacyanin-2 from Arabidopsis with 55.07% of identity
• Eggnog: copper ion binding electron carrier(ENOG410YVSJ)
• Kegg: Link to kegg annotations (AT2G44790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463954.1)
• Pfam: Plastocyanin-like domain (PF02298.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;