Protein coding transcript 153378

• Transcript: Ll_transcript_251272
• CDS coordinates: 283-1071 (+)
• Peptide sequence: MDLLLLEKTLTGLFIAVIVAIVVSKLRGKRFKLPPGPFPVPIFGNWLQVGDDLNHRNLTDLAKKFGEIFLLRMGQRNLVVISSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRFGWEDEAARVVDDVKRNPEAAAGGIVLRRRLQLMMYNNMYRIMFDTRFESEEDPLFVKLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFVEERK*
• ORF Type: complete

Annotations of Ll_transcript_251272

• Blastp: Trans-cinnamate 4-monooxygenase from Soja with 88.55% of identity
• Blastx: Trans-cinnamate 4-monooxygenase from Catharanthus with 91.16% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: Link to kegg annotations (100499623)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432343.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;