Protein coding transcript 153381

• Transcript: Ll_transcript_251279
• CDS coordinates: 2974-3600 (+)
• Peptide sequence: MHKLIIFVTAIETTLWSIEWGIAELVNHPHIQKKLREEINKVLGPGHQVTEPDIQKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGTFDIPAESKILVNAWWLANDPAHWKKPEEFRPERFLEEESKVEANGNDFRYLPFGVGRRSCPGIILAIPILGITLGRLVQNFELLPPPGQTKLDTTEKGGQFSLHILKHSTIVAKPILS*
• ORF Type: complete

Annotations of Ll_transcript_251279

• Blastp: Trans-cinnamate 4-monooxygenase from Glycyrrhiza with 91.5% of identity
• Blastx: Trans-cinnamate 4-monooxygenase from Catharanthus with 89.8% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432343.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;