Protein coding transcript 157469

• Transcript: Ll_transcript_106697
• CDS coordinates: 1459-1842 (+)
• Peptide sequence: MGLLNSIESKIILQTKLSVEGPLRMKEEYVEGVLVSPTVIEDRVPEQLKGALGQAANALQQLPAPIRDVVASGLKVPLSGSFQRLFMISYLDEEILIIRDTAGMPEVLTRLDASPSSLAESIPEYVS*
• ORF Type: complete

Annotations of Ll_transcript_106697

• Blastp: Probable plastid-lipid-associated protein 13, chloroplastic from Arabidopsis with 72.8% of identity
• Blastx: Probable plastid-lipid-associated protein 13, chloroplastic from Arabidopsis with 67.77% of identity
• Eggnog: plastid-lipid-associated protein(ENOG410Y4Z3)
• Kegg: Link to kegg annotations (AT2G42130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453345.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;