Protein coding transcript 158300

• Transcript: Ll_transcript_107162
• CDS coordinates: 3-743 (+)
• Peptide sequence: EKELKEEEERRMDPMEALITQIQGLSSSAADLSRLHTILKQATADVSLRSYSDHLPSLLSNLDPSLHSLGFLFILDASIASPVSKPQAEIFVPIVTTFIAACSVEQIQLAPDKFVSVCKKLKDQVVLLEAPIRGVAPMLTAVRKLQVSTERLTPLHPEFLLLCLLSKCYKTGLAILDDDIFEVDQPRDLFLFFYYGGMICIGQKRFQKALDLLHNVVTAPMSSLNAIAVEAYKKYILVSLIHHGTI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_107162

• Blastp: COP9 signalosome complex subunit 3 from Arabidopsis with 59.66% of identity
• Blastx: COP9 signalosome complex subunit 3 from Arabidopsis with 53.43% of identity
• Eggnog: COP9 (constitutive photomorphogenic) homolog, subunit 3 (Arabidopsis(ENOG410XRKY)
• Kegg: Link to kegg annotations (AT5G14250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427626.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;