Protein coding transcript 161331

• Transcript: Ll_transcript_224228
• CDS coordinates: 179-1264 (+)
• Peptide sequence: MIQDSKDRVEEEEESGCDENRPSKISKTSHNNTNSEAMNGKVQRYLVAIEYIGTHFSGSQQQPIHRTVIGVLQDAFSKFIGQPISITSSSRTDAGVHALSNVCHVDIERISKRKPGEVLPPHEPDVVRRAVNHFLQRDSDVTIIDVRCVPSDFHARYKALERTYFYRLLSGPEPLSTFEKDRAWHVPEELNIRAMQEACRVLVGHHDFSSFRASGCQAKSPIRTLDELGVCEVIPSQYFPSVKDREQHNKVSDDLHGCSSNSETDIPLSSLASIDKVTTLSEDVGFGKRRSHRCLVVTARSRAFLYHQVRLLVGVLKAVGTGNLTISDVERILNAKDVTAASPMAPACGLYLGEVKYDLSS*
• ORF Type: complete

Annotations of Ll_transcript_224228

• Blastp: tRNA pseudouridine synthase A from Magnetospirillum with 34.91% of identity
• Blastx: tRNA pseudouridine synthase A from Magnetospirillum with 34.91% of identity
• Eggnog: Formation of pseudouridine at positions 38, 39 and 40 in the anticodon stem and loop of transfer RNAs (By similarity)(COG0101)
• Kegg: Link to kegg annotations (amb0241)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424639.1)
• Pfam: tRNA pseudouridine synthase (PF01416.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;