Protein coding transcript 164728

• Transcript: Ll_transcript_246513
• CDS coordinates: 210-632 (+)
• Peptide sequence: MVSFEMNDRKKIGLGLTGFGVFFSFLGIIFFFDKGLLAMGNILFVSGVSLTIGLKSTMQFFMKRSNFKGTISFGIGFFILIMGWPILGMIVEAYGFIVLFSGFWPTLSVFIQKVPVLGWLFQQPFIRSVFDRNRGKRVPV*
• ORF Type: complete

Annotations of Ll_transcript_246513

• Blastp: Vesicle transport protein GOT1 from Arabidopsis with 71.43% of identity
• Blastx: Vesicle transport protein GOT1 from Arabidopsis with 71.43% of identity
• Eggnog: golgi transport(COG5120)
• Kegg: Link to kegg annotations (AT3G03180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455937.1)
• Pfam: Got1/Sft2-like family (PF04178.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;