Protein coding transcript 165016

• Transcript: Ll_transcript_246989
• CDS coordinates: 275-847 (+)
• Peptide sequence: MEYVYPGSINKFMHDHCGAMTESMVRNFTWHILSGLAYLHSKKTIHRDIKGPNLLVNASGTIKLADFGVAKILTGKSYQLSLKGSPYWMAPELMMAAIKKESSPNLAMAVDIWSLGCTIIEMLTGKPPWSEFEEAQAMFKVLHKSPTIPETLSSEGQDFLRQCFRRNPADRPSAAMLLTHAFVQNLHDQL*
• ORF Type: complete

Annotations of Ll_transcript_246989

• Blastp: Mitogen-activated protein kinase kinase kinase 5 from Arabidopsis with 74.05% of identity
• Blastx: Mitogen-activated protein kinase kinase kinase 5 from Arabidopsis with 72.35% of identity
• Eggnog: mitogen-activated protein kinase kinase kinase(ENOG410XQGS)
• Kegg: Link to kegg annotations (AT5G66850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437995.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;