Protein coding transcript 165190

• Transcript: Ll_transcript_127701
• CDS coordinates: 594-1469 (+)
• Peptide sequence: MTARPYVTGQGTFDNSTVAGTLEYKVPSRTQNSAASLKNLPLFQPILPALNDTSFATKFANKLRSLSSAEFPANVPQTVDKHFLFTVSLGTSPCQKNQTCQGPTNGTKFAASVNNVSFTLPTTALLQSHFFGQSNGIYSSNFPTSPLVPFNYTGTPLNNTMVSNGTKVMVLPFNTSVELIMQDTSILGAESHPLHLHGFNFFVVGQGFGNFDPNKDPAKFNLVDPVERNTIGVPSGGWVAIRFLADNPGVWFMHCHLEVHTSWGLRMAWVVLDGKLPNQKLFPPPPDLPKC*
• ORF Type: complete

Annotations of Ll_transcript_127701

• Blastp: Laccase-17 from Arabidopsis with 79.32% of identity
• Blastx: Laccase-17 from Arabidopsis with 80.14% of identity
• Eggnog: Multicopper oxidase(COG2132)
• Kegg: Link to kegg annotations (AT5G60020)
• CantataDB: Link to cantataDB annotations (CNT0001549)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459094.1)
• Pfam: Multicopper oxidase (PF07731.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;