Protein coding transcript 167073

• Transcript: Ll_transcript_180392
• CDS coordinates: 233-709 (+)
• Peptide sequence: MVDKTVRFGILGCANVARKVARAISLSPNATLSAIASRSVTKAENFAAENNLPESVRIYGSYDQVLEDPGVDVVYVPLPTSLHVRWVVMAAEKKKHVLVEKPVALDVVELDRILEACESNGVQFMDGSMWLHHPRTDHMENLFSLTNSKGIGQVHFVS*
• ORF Type: complete

Annotations of Ll_transcript_180392

• Blastp: Uncharacterized oxidoreductase At4g09670 from Arabidopsis with 56.41% of identity
• Blastx: Uncharacterized oxidoreductase At4g09670 from Arabidopsis with 58.74% of identity
• Eggnog: oxidoreductase(COG0673)
• Kegg: Link to kegg annotations (AT4G09670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439511.1)
• Pfam: Oxidoreductase family, NAD-binding Rossmann fold (PF01408.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;