Protein coding transcript 168217

• Transcript: Ll_transcript_182340
• CDS coordinates: 656-1540 (+)
• Peptide sequence: MLFTWYAPILTTSLFLSLFSYKESTIEKKRSVGIIIIYYMAFLDDTLCVKGEVVKDWREIVTYFSYPIGKRDYSRWPEKPEGWIKVTEEYSEKLMNLACKLLEVLSEAMGLEKEALTKACIDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLVQDQVGGLQATRDDGKTWITVQPIQGAFIVNLGDHGHYLSNGRFKNADHQAVVNSNCSRLSIATFQNPAPEAKVYPLMVREGDKPILKEPISFSEMYKMKMNKDIEISRLKKVAKEKKQLQNINKDKLETKPIEEILA*
• ORF Type: complete

Annotations of Ll_transcript_182340

• Blastp: Naringenin,2-oxoglutarate 3-dioxygenase from Petunia with 80.32% of identity
• Blastx: Naringenin,2-oxoglutarate 3-dioxygenase from Petunia with 80.32% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420370.1)
• Pfam: 2OG-Fe(II) oxygenase superfamily (PF03171.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;