Protein coding transcript 170001

• Transcript: Ll_transcript_263455
• CDS coordinates: 207-632 (+)
• Peptide sequence: MGKDGKSGAKGKGKAGGSDENASKGKGKGAKGGDGLGTCTYVKARHILCEKQGKINEAYKKLQDGWLSNGDKVPPAEFAKVAQEYSECPSGKKGGDLGWFPRGKMAGPFQEVAFNTPVGVTSAPFKSTHGYHIILSEGRKN*
• ORF Type: complete

Annotations of Ll_transcript_263455

• Blastp: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 from Bos with 46.83% of identity
• Blastx: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 from Bos with 50.48% of identity
• Eggnog: peptidyl-prolyl cis-trans isomerase(COG0760)
• Kegg: Link to kegg annotations (100126055)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004500009.1)
• Pfam: PPIC-type PPIASE domain (PF13616.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;