Protein coding transcript 172073

• Transcript: Ll_transcript_23955
• CDS coordinates: 1-654 (+)
• Peptide sequence: AHQKGVNCVDYFTGGDKPYLITGSDDHTAKVWDYQTKSCVQTLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHSTTYRLENTLNYSLERVWAIGYLKGSRRVVIGYDEGTIMVKLGREEPVASMDNSGKIIWAKHNEIQTVNIRSVGADVEIVDGERLPLAVKELGTCDLYPQVQLSSPLVCFFVYVGLVVLLVICFQYSELKAQSKWKVCCCMW*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_23955

• Blastp: Coatomer subunit beta'-2 from Arabidopsis with 87.37% of identity
• Blastx: Coatomer subunit beta'-2 from Arabidopsis with 90.06% of identity
• Eggnog: coatomer protein complex, subunit beta 2 (beta prime)(ENOG410XNNY)
• Kegg: Link to kegg annotations (AT1G52360)
• CantataDB: Link to cantataDB annotations (CNT0002993)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014634628.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;