Protein coding transcript 172489

• Transcript: Ll_transcript_25396
• CDS coordinates: 1705-2646 (+)
• Peptide sequence: MESGDFNRALQYYKEAVKLKPSFPDAYLNLGNVYKALGMPQEAIVCYQHALQTRSNYGMAYGNLASVYYEQGQLDMAILHYKQAVACDPRFLEAYNNLGNALKDFGRVDEAIQCYNQCLSLQPNHPQALTNLGNIYMEWNMVSAAASYYKATLSVTTGLSAPYNNLAIIYKQQGNYADAITCYNEVLRIDPLAADGLVNRGNTYKEIGRVSEAIQDYIRAITVRPTMAEAHANLASAYKDSGLVEAAVKSYRQALILRTDFPEATCNLLHTLQVLIILIVFIFQHEFIGASFGRDLSHMLWEFILGASNLFYI*
• ORF Type: complete

Annotations of Ll_transcript_25396

• Blastp: Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC from Arabidopsis with 82.91% of identity
• Blastx: Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC from Arabidopsis with 83.89% of identity
• Eggnog: protein N-acetylglucosaminyltransferase activity(COG3914)
• Kegg: Link to kegg annotations (AT3G04240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452206.1)
• Pfam: Tetratricopeptide repeat (PF14559.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;