Protein coding transcript 1733

• Transcript: Ll_transcript_318147
• CDS coordinates: 67-450 (+)
• Peptide sequence: MSQPSLAQFVMKRPWMMRWAQPLSNWYLNSAGYRQLGLRADDLIPEESELVQRALKRLSPKESYDRVFRMRRAFQCSLAHQLLPKTEWTKPEDDTPYISPIIAELEAEVTERQDLEAMVINKPTIKK*
• ORF Type: complete

Annotations of Ll_transcript_318147

• Blastp: Cytochrome b-c1 complex subunit 7 from Neurospora with 59.02% of identity
• Blastx: Cytochrome b-c1 complex subunit 7 from Neurospora with 59.02% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (NCU08940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437715.1)
• Pfam: Ubiquinol-cytochrome C reductase complex 14kD subunit (PF02271.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;