Protein coding transcript 177564

• Transcript: Ll_transcript_43901
• CDS coordinates: 3-335 (+)
• Peptide sequence: LTIWLDSNSGSVFKSLHSYQSGYFGAAIKLQQGYTAGVITCLYLSNNQVYPRNHDEIDIEFLGTTPNKPYILQTNVFTMMKLTLSSLVPRQISHIYCRQMCSSEEVEKET*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_43901

• Blastp: Xyloglucan endotransglucosylase/hydrolase protein 31 from Arabidopsis with 59.26% of identity
• Blastx: Xyloglucan endotransglucosylase/hydrolase protein 31 from Arabidopsis with 59.26% of identity
• Eggnog: xyloglucan endotransglucosylase hydrolase protein(ENOG411167N)
• Kegg: Link to kegg annotations (AT3G44990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447816.1)
• Pfam: Glycosyl hydrolases family 16 (PF00722.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;