Protein coding transcript 17759

• Transcript: Ll_transcript_356228
• CDS coordinates: 165-872 (+)
• Peptide sequence: MATSSEATNESSPMKDAFTKYAQYLNDLNDKRERVVKASRDITMNSKKVIFQVHRLSKYNRDEVLEKAEKDLAAVTDQYISRLVRELQGTDFWKLRRAYSPGIQEYVEAATFCSFCKNGTLLKLDEINNTLLPLSDPSIEPLQINILDYLLGIADLTGELMRLAIGRISDGELEFAEKICRFARDIYRELTLVVPHMDASSDMKTKMDTMLQSVMKIENGIRFQNTVCKTNVSIY*
• ORF Type: complete

Annotations of Ll_transcript_356228

• Blastp: Translin-associated protein X from Macaca with 37.12% of identity
• Blastx: Translin-associated protein X from Macaca with 37.12% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (101866421)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423339.1)
• Pfam: Translin family (PF01997.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;