Protein coding transcript 181674

• Transcript: Ll_transcript_239231
• CDS coordinates: 1982-2422 (+)
• Peptide sequence: MQLLHTKYSCKESSNCTRAERILEESKNQGILLNQFVIVSPYETDNYTSIGQAIDAAPNNTKPEDGYFLIYVREGYYEEYVIVPKEKKNILLIGDGINKTVITGNHSVIDGWTTFNSATFGKCLIVYKLFSFASLFVTITSHKRYY*
• ORF Type: complete

Annotations of Ll_transcript_239231

• Blastp: Probable pectinesterase/pectinesterase inhibitor 25 from Arabidopsis with 54.24% of identity
• Blastx: Probable pectinesterase/pectinesterase inhibitor 47 from Arabidopsis with 76.92% of identity
• Eggnog: pectinesterase(COG4677)
• Kegg: Link to kegg annotations (AT3G10720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440880.1)
• Pfam: Pectinesterase (PF01095.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;