Protein coding transcript 184547

• Transcript: Ll_transcript_1539
• CDS coordinates: 639-998 (+)
• Peptide sequence: MYAVIACAYSLVLLMGSVAYDDGMRDEEKNGGSFRTVYVVSGLLLVPLSIALCVLLGWHIYLILHNKTTIEYHEGVRALSLTEKGGSIYKHPYDLGPYENLTSVRTCCFHFLGFGAKYH*
• ORF Type: complete

Annotations of Ll_transcript_1539

• Blastp: Probable protein S-acyltransferase 16 from Arabidopsis with 70.59% of identity
• Blastx: Probable protein S-acyltransferase 16 from Arabidopsis with 73.02% of identity
• Eggnog: Zinc finger, DHHC-type containing(COG5273)
• Kegg: Link to kegg annotations (AT3G09320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465121.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;