Protein coding transcript 185004

• Transcript: Ll_transcript_1568
• CDS coordinates: 775-1314 (+)
• Peptide sequence: MKEWSCCKKRSHDFSLFLQIPGCKTGKHTSEKQVIAPVKKNTVPAPAAASLTNASSTDSCSRCRQGFFCSDHGSQGKLVEKPVNVAGDATSENKIFVAPKPPKKIVDINEPQICRNQGCGQTFKEKDNHDTACSYHPGPAVFHDRMKGWKCCDIHVKEFDEFITIPPCTKGWHNADPGS*
• ORF Type: complete

Annotations of Ll_transcript_1568

• Blastp: Cysteine and histidine-rich domain-containing protein RAR1 from Arabidopsis with 67.04% of identity
• Blastx: Cysteine and histidine-rich domain-containing protein RAR1 from Arabidopsis with 67.38% of identity
• Eggnog: cysteine and histidine-rich domain (CHORD) containing 1(ENOG410XPV6)
• Kegg: Link to kegg annotations (AT5G51700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426573.1)
• Pfam: CHORD (PF04968.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;